TPD52 purified MaxPab rabbit polyclonal antibody (D01P)
  • TPD52 purified MaxPab rabbit polyclonal antibody (D01P)

TPD52 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00007163-D01P
TPD52 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human TPD52 protein.
Información adicional
Size 100 ug
Gene Name TPD52
Gene Alias D52|N8L|PC-1|PrLZ|hD52
Gene Description tumor protein D52
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MDRGEQGLLRTDPVPEEGEDVAATISATETLSEEEQEELRRELAKVEEEIQTLSQVLAAKEKHLAEIKRKLGINSLQELKQNIAKGWQDVTATSAYKKTSETLSQAGQKASAAFSSVGSVITKKLEDVKNSPTFKSFEEKVENLKSKVGGTKPAGGDFGEVLNSAANASATTTEPLPEKTQESL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TPD52 (AAH18117.1, 1 a.a. ~ 184 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7163

Enviar un mensaje


TPD52 purified MaxPab rabbit polyclonal antibody (D01P)

TPD52 purified MaxPab rabbit polyclonal antibody (D01P)