TPBG monoclonal antibody (M09), clone 1B6
  • TPBG monoclonal antibody (M09), clone 1B6

TPBG monoclonal antibody (M09), clone 1B6

Ref: AB-H00007162-M09
TPBG monoclonal antibody (M09), clone 1B6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TPBG.
Información adicional
Size 100 ug
Gene Name TPBG
Gene Alias 5T4|5T4-AG|M6P1
Gene Description trophoblast glycoprotein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,S-ELISA,ELISA
Immunogen Prot. Seq SNHFLYLPRDVLAQLPSLRHLDLSNNSLVSLTYVSFRNLTHLESLHLEDNALKVLHNGTLAELQGLPHIRVFLDNNPWVCDCHMADMVTWLKETEVVQGKDRLTCAYPEK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TPBG (NP_006661, 219 a.a. ~ 328 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7162
Clone Number 1B6
Iso type IgG2b Kappa

Enviar un mensaje


TPBG monoclonal antibody (M09), clone 1B6

TPBG monoclonal antibody (M09), clone 1B6