TP53BP2 polyclonal antibody (A01)
  • TP53BP2 polyclonal antibody (A01)

TP53BP2 polyclonal antibody (A01)

Ref: AB-H00007159-A01
TP53BP2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant TP53BP2.
Información adicional
Size 50 uL
Gene Name TP53BP2
Gene Alias 53BP2|ASPP2|BBP|PPP1R13A|p53BP2
Gene Description tumor protein p53 binding protein, 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq PYFGQTNQPPSDIKPDGSSQQLSTVVPSMGTKPKPAGQQPRVLLSPSIPSVGQDQTLSPGSKQESPPAAAVRPFTPQPSKDTLLPPFRKPQTVAASSIYS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TP53BP2 (AAH58918, 511 a.a. ~ 610 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 7159

Enviar un mensaje


TP53BP2 polyclonal antibody (A01)

TP53BP2 polyclonal antibody (A01)