TP53 monoclonal antibody (M04), clone 2C11
  • TP53 monoclonal antibody (M04), clone 2C11

TP53 monoclonal antibody (M04), clone 2C11

Ref: AB-H00007157-M04
TP53 monoclonal antibody (M04), clone 2C11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TP53.
Información adicional
Size 100 ug
Gene Name TP53
Gene Alias FLJ92943|LFS1|TRP53|p53
Gene Description tumor protein p53
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,IHC-P,S-ELISA,ELISA,RNAi-Ab,PLA-Ce
Immunogen Prot. Seq SSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TP53 (AAH03596, 94 a.a. ~ 201 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7157
Clone Number 2C11
Iso type IgG1 Kappa

Enviar un mensaje


TP53 monoclonal antibody (M04), clone 2C11

TP53 monoclonal antibody (M04), clone 2C11