TP53 MaxPab rabbit polyclonal antibody (D01)
  • TP53 MaxPab rabbit polyclonal antibody (D01)

TP53 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00007157-D01
TP53 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human TP53 protein.
Información adicional
Size 100 uL
Gene Name TP53
Gene Alias FLJ92943|LFS1|TRP53|p53
Gene Description tumor protein p53
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTII
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TP53 (NP_000537.2, 1 a.a. ~ 393 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 7157

Enviar un mensaje


TP53 MaxPab rabbit polyclonal antibody (D01)

TP53 MaxPab rabbit polyclonal antibody (D01)