TP53 polyclonal antibody (A01)
  • TP53 polyclonal antibody (A01)

TP53 polyclonal antibody (A01)

Ref: AB-H00007157-A01
TP53 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant TP53.
Información adicional
Size 50 uL
Gene Name TP53
Gene Alias FLJ92943|LFS1|TRP53|p53
Gene Description tumor protein p53
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq SSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TP53 (AAH03596, 94 a.a. ~ 201 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 7157

Enviar un mensaje


TP53 polyclonal antibody (A01)

TP53 polyclonal antibody (A01)