TOP2B polyclonal antibody (A01)
  • TOP2B polyclonal antibody (A01)

TOP2B polyclonal antibody (A01)

Ref: AB-H00007155-A01
TOP2B polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant TOP2B.
Información adicional
Size 50 uL
Gene Name TOP2B
Gene Alias TOPIIB|top2beta
Gene Description topoisomerase (DNA) II beta 180kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LDKDEYTFSPGKSKATPEKSLHDKKSQDFGNLFSFPSYSQKSEDDSAKFDSNEEDSASVFSPSFGLKQTDKVPSKTVAAKKGKPSSDTVPKPKRAPKQKKVVEAVNSDSDSEF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TOP2B (NP_001059, 1411 a.a. ~ 1523 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 7155

Enviar un mensaje


TOP2B polyclonal antibody (A01)

TOP2B polyclonal antibody (A01)