TOP2A monoclonal antibody (M01), clone 1E2
  • TOP2A monoclonal antibody (M01), clone 1E2

TOP2A monoclonal antibody (M01), clone 1E2

Ref: AB-H00007153-M01
TOP2A monoclonal antibody (M01), clone 1E2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TOP2A.
Información adicional
Size 100 ug
Gene Name TOP2A
Gene Alias TOP2|TP2A
Gene Description topoisomerase (DNA) II alpha 170kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq RAAPKGTKRDPALNSGVSQKPDPAKTKNRRKRKPSTSDDSDSNFEKIVSKAVTSKKSKGESDDFHMDFDSAVAPRAKSVRAKKPIKYLEESDEDDLF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TOP2A (NP_001058, 1435 a.a. ~ 1531 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7153
Clone Number 1E2
Iso type IgG1 Kappa

Enviar un mensaje


TOP2A monoclonal antibody (M01), clone 1E2

TOP2A monoclonal antibody (M01), clone 1E2