TNP1 monoclonal antibody (M02A), clone 1F12
  • TNP1 monoclonal antibody (M02A), clone 1F12

TNP1 monoclonal antibody (M02A), clone 1F12

Ref: AB-H00007141-M02A
TNP1 monoclonal antibody (M02A), clone 1F12

Información del producto

Mouse monoclonal antibody raised against a full length recombinant TNP1.
Información adicional
Size 200 uL
Gene Name TNP1
Gene Alias TP1
Gene Description transition protein 1 (during histone to protamine replacement)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq MSTSRKLKSHGMRRSKSRSPHKGVKRGGSKRKYRKGNLKSRKRGDDANRNYRSHL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TNP1 (AAH29516.1, 1 a.a. ~ 55 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 7141
Clone Number 1F12
Iso type IgM kappa

Enviar un mensaje


TNP1 monoclonal antibody (M02A), clone 1F12

TNP1 monoclonal antibody (M02A), clone 1F12