Ver mas grande
TNNT3 polyclonal antibody (A01)
AB-H00007140-A01
Producto nuevo
TNNT3 polyclonal antibody (A01)
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 50 uL |
| Gene Name | TNNT3 |
| Gene Alias | AMCD2B|DA2B|DKFZp779M2348|FSSV |
| Gene Description | troponin T type 3 (skeletal, fast) |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,ELISA |
| Immunogen Prot. Seq | ADQKRGKKQTAREMKKKILAERRKPLNIDHLGEDKLRDKAKELWETLHQLEIDKFEFGEKLKRQKYDITTLRSRIDQAQKHSKKAGTPAKGKVGGRWK |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | TNNT3 (NP_006748, 161 a.a. ~ 258 a.a) partial recombinant protein with GST tag. |
| Storage Buffer | 50 % glycerol |
| Gene ID | 7140 |
Más información
Mouse polyclonal antibody raised against a partial recombinant TNNT3.