TNNT3 polyclonal antibody (A01) Ver mas grande

TNNT3 polyclonal antibody (A01)

AB-H00007140-A01

Producto nuevo

TNNT3 polyclonal antibody (A01)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.


Hoja técnica

Size 50 uL
Gene Name TNNT3
Gene Alias AMCD2B|DA2B|DKFZp779M2348|FSSV
Gene Description troponin T type 3 (skeletal, fast)
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq ADQKRGKKQTAREMKKKILAERRKPLNIDHLGEDKLRDKAKELWETLHQLEIDKFEFGEKLKRQKYDITTLRSRIDQAQKHSKKAGTPAKGKVGGRWK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TNNT3 (NP_006748, 161 a.a. ~ 258 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 7140

Más información

Mouse polyclonal antibody raised against a partial recombinant TNNT3.

Consulta sobre un producto

TNNT3 polyclonal antibody (A01)

TNNT3 polyclonal antibody (A01)