TNNT1 purified MaxPab rabbit polyclonal antibody (D01P)
  • TNNT1 purified MaxPab rabbit polyclonal antibody (D01P)

TNNT1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00007138-D01P
TNNT1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human TNNT1 protein.
Información adicional
Size 100 ug
Gene Name TNNT1
Gene Alias ANM|FLJ98147|MGC104241|STNT|TNT|TNTS
Gene Description troponin T type 1 (skeletal, slow)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSDTEEQEYEEEQPEEEAAEEEEEEEERPKPSRPVVPPLIPPKIPEGERVDFDDIHRKRMEKDLLELQTLIDVHFEQRKKEEEELVALKERIERRRSERAEQQRFRTEKERERQAKLAEEKMRKEEEEAKKRAEDDAKKKKVLSNMGAHFGGYLVKAEQKRGKRQTGREMKVRILSERKKPLDIDYMGEEQLREKAQELSDWIHQLESEKFDLMAKLKQQKYEINVLYNRISHAQKFRKGAGKGRVGGRWK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TNNT1 (NP_003274.1, 1 a.a. ~ 251 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7138

Enviar un mensaje


TNNT1 purified MaxPab rabbit polyclonal antibody (D01P)

TNNT1 purified MaxPab rabbit polyclonal antibody (D01P)