TNFRSF1A purified MaxPab mouse polyclonal antibody (B01P)
  • TNFRSF1A purified MaxPab mouse polyclonal antibody (B01P)

TNFRSF1A purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00007132-B01P
TNFRSF1A purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human TNFRSF1A protein.
Información adicional
Size 50 ug
Gene Name TNFRSF1A
Gene Alias CD120a|FPF|MGC19588|TBP1|TNF-R|TNF-R-I|TNF-R55|TNFAR|TNFR1|TNFR55|TNFR60|p55|p55-R|p60
Gene Description tumor necrosis factor receptor superfamily, member 1A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MGLSTVPDLLLPLVLLELLVGIYPSGVIGLVPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIENVKGTEDSGTTVLLPLVIFFGLCLLSLLFIGLMYRYQRWKSKLYSIVCGKSTPEK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TNFRSF1A (ABW03527.1, 1 a.a. ~ 455 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7132

Enviar un mensaje


TNFRSF1A purified MaxPab mouse polyclonal antibody (B01P)

TNFRSF1A purified MaxPab mouse polyclonal antibody (B01P)