TNFRSF1A polyclonal antibody (A01)
  • TNFRSF1A polyclonal antibody (A01)

TNFRSF1A polyclonal antibody (A01)

Ref: AB-H00007132-A01
TNFRSF1A polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant TNFRSF1A.
Información adicional
Size 50 uL
Gene Name TNFRSF1A
Gene Alias CD120a|FPF|MGC19588|TBP1|TNF-R|TNF-R-I|TNF-R55|TNFAR|TNFR1|TNFR55|TNFR60|p55|p55-R|p60
Gene Description tumor necrosis factor receptor superfamily, member 1A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq RDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TNFRSF1A (NP_001056, 40 a.a. ~ 149 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 7132

Enviar un mensaje


TNFRSF1A polyclonal antibody (A01)

TNFRSF1A polyclonal antibody (A01)