TNFAIP2 monoclonal antibody (M01), clone 7H1
  • TNFAIP2 monoclonal antibody (M01), clone 7H1

TNFAIP2 monoclonal antibody (M01), clone 7H1

Ref: AB-H00007127-M01
TNFAIP2 monoclonal antibody (M01), clone 7H1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TNFAIP2.
Información adicional
Size 100 ug
Gene Name TNFAIP2
Gene Alias B94
Gene Description tumor necrosis factor, alpha-induced protein 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq YILANADTIQHFCTQHGSPATWLQPALPTLAEIIRLQDPSAIKIEVATYATCYPDFSKGHLSAILAIKGNLSNSEVKRIRSILDVSMGAQEPSRPLFSL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TNFAIP2 (NP_006282, 552 a.a. ~ 650 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7127
Clone Number 7H1
Iso type IgG2a Kappa

Enviar un mensaje


TNFAIP2 monoclonal antibody (M01), clone 7H1

TNFAIP2 monoclonal antibody (M01), clone 7H1