TNNC2 polyclonal antibody (A01)
  • TNNC2 polyclonal antibody (A01)

TNNC2 polyclonal antibody (A01)

Ref: AB-H00007125-A01
TNNC2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant TNNC2.
Información adicional
Size 50 uL
Gene Name TNNC2
Gene Alias -
Gene Description troponin C type 2 (fast)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MTDQQAEARSYLSEEMIAEFKAAFDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELAECFRIFDRNADGYIDPEELAEIFRASGEHVTDEEIESLMKDGDKNNDGRIDFDEFLKMMEGVQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TNNC2 (AAH05323, 1 a.a. ~ 160 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 7125

Enviar un mensaje


TNNC2 polyclonal antibody (A01)

TNNC2 polyclonal antibody (A01)