TNF polyclonal antibody (A01)
  • TNF polyclonal antibody (A01)

TNF polyclonal antibody (A01)

Ref: AB-H00007124-A01
TNF polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant TNF.
Información adicional
Size 50 uL
Gene Name TNF
Gene Alias DIF|TNF-alpha|TNFA|TNFSF2
Gene Description tumor necrosis factor (TNF superfamily, member 2)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq LVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TNF (NP_000585, 124 a.a. ~ 233 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 7124

Enviar un mensaje


TNF polyclonal antibody (A01)

TNF polyclonal antibody (A01)