TMPRSS2 monoclonal antibody (M05), clone 2F4
  • TMPRSS2 monoclonal antibody (M05), clone 2F4

TMPRSS2 monoclonal antibody (M05), clone 2F4

Ref: AB-H00007113-M05
TMPRSS2 monoclonal antibody (M05), clone 2F4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TMPRSS2.
Información adicional
Size 100 ug
Gene Name TMPRSS2
Gene Alias FLJ41954|PP9284|PRSS10
Gene Description transmembrane protease, serine 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq GWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TMPRSS2 (NP_005647, 383 a.a. ~ 492 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7113
Clone Number 2F4
Iso type IgG2a Kappa

Enviar un mensaje


TMPRSS2 monoclonal antibody (M05), clone 2F4

TMPRSS2 monoclonal antibody (M05), clone 2F4