TMPRSS2 purified MaxPab mouse polyclonal antibody (B01P)
  • TMPRSS2 purified MaxPab mouse polyclonal antibody (B01P)

TMPRSS2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00007113-B01P
TMPRSS2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human TMPRSS2 protein.
Información adicional
Size 50 ug
Gene Name TMPRSS2
Gene Alias FLJ41954|PP9284|PRSS10
Gene Description transmembrane protease, serine 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MALNSGSPPAIGPYYENHGYQPENPYPAQPTVVPTVYEVHPAQYYPSPVPQYAPRVLTQASNPVVCTQPKSPSGTVCTSKTKKALCITLTLGTFLVGAALAAGLLWKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TMPRSS2 (AAH51839.1, 1 a.a. ~ 492 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7113

Enviar un mensaje


TMPRSS2 purified MaxPab mouse polyclonal antibody (B01P)

TMPRSS2 purified MaxPab mouse polyclonal antibody (B01P)