TLR5 monoclonal antibody (M05), clone 3H6
  • TLR5 monoclonal antibody (M05), clone 3H6

TLR5 monoclonal antibody (M05), clone 3H6

Ref: AB-H00007100-M05
TLR5 monoclonal antibody (M05), clone 3H6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TLR5.
Información adicional
Size 100 ug
Gene Name TLR5
Gene Alias FLJ10052|MGC126430|MGC126431|SLEB1|TIL3
Gene Description toll-like receptor 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq LPPGVFSHLTALRGLSLNSNRLTVLSHNDLPANLEILDISRNQLLAPNPDVFVSLSVLDITHNKFICECELSTFINWLNHTNVTIAGPPADIYCVYPDSFSGVSLFSLSTEGCDEEEV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TLR5 (NP_003259, 517 a.a. ~ 634 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7100
Clone Number 3H6
Iso type IgG2b Kappa

Enviar un mensaje


TLR5 monoclonal antibody (M05), clone 3H6

TLR5 monoclonal antibody (M05), clone 3H6