TLR4 monoclonal antibody (M16), clone 3G12
  • TLR4 monoclonal antibody (M16), clone 3G12

TLR4 monoclonal antibody (M16), clone 3G12

Ref: AB-H00007099-M16
TLR4 monoclonal antibody (M16), clone 3G12

Información del producto

Mouse monoclonal antibody raised against a full length recombinant TLR4.
Información adicional
Size 100 ug
Gene Name TLR4
Gene Alias ARMD10|CD284|TOLL|hToll
Gene Description toll-like receptor 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq KLVAVETNLASLENFPIGHLKTLKELNVAHNLIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYCTDLRVLHQM
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TLR4 (NP_612564.1, 130 a.a. ~ 201 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7099
Clone Number 3G12
Iso type IgG2b Kappa

Enviar un mensaje


TLR4 monoclonal antibody (M16), clone 3G12

TLR4 monoclonal antibody (M16), clone 3G12