TLR4 polyclonal antibody (A01)
  • TLR4 polyclonal antibody (A01)

TLR4 polyclonal antibody (A01)

Ref: AB-H00007099-A01
TLR4 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant TLR4.
Información adicional
Size 50 uL
Gene Name TLR4
Gene Alias ARMD10|CD284|TOLL|hToll
Gene Description toll-like receptor 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq PMNFIQPGAFKEIRLHKLTLRNNFDSLNVMKTCIQGLAGLEVHRLVLGEFRNEGNLEKFDKSALEGLCNLTIEEFRLA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TLR4 (NP_612564, 214 a.a. ~ 291 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 7099

Enviar un mensaje


TLR4 polyclonal antibody (A01)

TLR4 polyclonal antibody (A01)