TKT purified MaxPab rabbit polyclonal antibody (D01P)
  • TKT purified MaxPab rabbit polyclonal antibody (D01P)

TKT purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00007086-D01P
TKT purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human TKT protein.
Información adicional
Size 100 ug
Gene Name TKT
Gene Alias FLJ34765|TKT1
Gene Description transketolase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr
Immunogen Prot. Seq MESYHKPDQQKLQALKDTANRLRISSIQATTAAGSGHPTSCCSAAEIMAVLFFHTMRYKSQDPRNPHNDRFVLSKGHAAPILYAVWAEAGFLAEAELLNLRKISSDLDGHPVPKQAFTDVATGSLGQGLGAACGMAYTGKYFDKASYRVYCLLGDGELSEGSVWEAMAFASIYKLDNLVAILDINRLGQSDPAPLQHQMDIYQKRCEAFGWHAIIVDGHSVEELCKAFGQAKHQPTAIIAKTFKGRGITGVEDKE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TKT (NP_001055.1, 1 a.a. ~ 623 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7086

Enviar un mensaje


TKT purified MaxPab rabbit polyclonal antibody (D01P)

TKT purified MaxPab rabbit polyclonal antibody (D01P)