TKT MaxPab rabbit polyclonal antibody (D01)
  • TKT MaxPab rabbit polyclonal antibody (D01)

TKT MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00007086-D01
TKT MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human TKT protein.
Información adicional
Size 100 uL
Gene Name TKT
Gene Alias FLJ34765|TKT1
Gene Description transketolase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr,IP
Immunogen Prot. Seq MESYHKPDQQKLQALKDTANRLRISSIQATTAAGSGHPTSCCSAAEIMAVLFFHTMRYKSQDPRNPHNDRFVLSKGHAAPILYAVWAEAGFLAEAELLNLRKISSDLDGHPVPKQAFTDVATGSLGQGLGAACGMAYTGKYFDKASYRVYCLLGDGELSEGSVWEAMAFASIYKLDNLVAILDINRLGQSDPAPLQHQMDIYQKRCEAFGWHAIIVDGHSVEELCKAFGQAKHQPTAIIAKTFKGRGITGVEDKE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TKT (NP_001055.1, 1 a.a. ~ 623 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 7086

Enviar un mensaje


TKT MaxPab rabbit polyclonal antibody (D01)

TKT MaxPab rabbit polyclonal antibody (D01)