TIMP3 monoclonal antibody (M01), clone 1D8
  • TIMP3 monoclonal antibody (M01), clone 1D8

TIMP3 monoclonal antibody (M01), clone 1D8

Ref: AB-H00007078-M01
TIMP3 monoclonal antibody (M01), clone 1D8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TIMP3.
Información adicional
Size 100 ug
Gene Name TIMP3
Gene Alias HSMRK222|K222|K222TA2|SFD
Gene Description TIMP metallopeptidase inhibitor 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq KMYTGLCNFVERWDQLTLSQRKGLNYRYHLGCNCKIKSCYYLPCFVTSKNECLWTDMLSNFGYPGYQSKHYACIRQKGGYCSWYRGWAPPDKSIINATDP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TIMP3 (AAH14277, 112 a.a. ~ 211 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7078
Clone Number 1D8
Iso type IgG2a Kappa

Enviar un mensaje


TIMP3 monoclonal antibody (M01), clone 1D8

TIMP3 monoclonal antibody (M01), clone 1D8