KLF10 monoclonal antibody (M65J), clone 7C1
  • KLF10 monoclonal antibody (M65J), clone 7C1

KLF10 monoclonal antibody (M65J), clone 7C1

Ref: AB-H00007071-M65J
KLF10 monoclonal antibody (M65J), clone 7C1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant KLF10.
This product is belong to Cell Culture Grade Antibody (CX Grade).
Información adicional
Size 100 ug
Gene Name KLF10
Gene Alias EGRA|TIEG|TIEG1
Gene Description Kruppel-like factor 10
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LSDTAKPHIAAPFKEEEKSPVSAPKLPKAQATSVIRHTADAQLCNHQTCPMKAASILNYQNNSFRRRTHLNVEAARKNIPCAAVSPNRSKCERNTVADVD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen KLF10 (AAH11538.1, 111 a.a. ~ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7071
Clone Number 7C1
Iso type IgG2a Kappa

Enviar un mensaje


KLF10 monoclonal antibody (M65J), clone 7C1

KLF10 monoclonal antibody (M65J), clone 7C1