Ver mas grande
KLF10 monoclonal antibody (M65), clone 7C1
AB-H00007071-M65
Producto nuevo
KLF10 monoclonal antibody (M65), clone 7C1
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | KLF10 |
| Gene Alias | EGRA|TIEG|TIEG1 |
| Gene Description | Kruppel-like factor 10 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,ELISA |
| Immunogen Prot. Seq | LSDTAKPHIAAPFKEEEKSPVSAPKLPKAQATSVIRHTADAQLCNHQTCPMKAASILNYQNNSFRRRTHLNVEAARKNIPCAAVSPNRSKCERNTVADVD |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | KLF10 (AAH11538.1, 111 a.a. ~ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 7071 |
| Clone Number | 7C1 |
| Iso type | IgG2a Lambda |
Más información
Mouse monoclonal antibody raised against a partial recombinant KLF10.