THY1 MaxPab mouse polyclonal antibody (B01)
  • THY1 MaxPab mouse polyclonal antibody (B01)

THY1 MaxPab mouse polyclonal antibody (B01)

Ref: AB-H00007070-B01
THY1 MaxPab mouse polyclonal antibody (B01)

Información del producto

Mouse polyclonal antibody raised against a full-length human THY1 protein.
Información adicional
Size 50 uL
Gene Name THY1
Gene Alias CD90|FLJ33325
Gene Description Thy-1 cell surface antigen
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MNLAISIALLLTVLQVSRGQKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKCEGISLLAQNTSWLLLLLLSLSLLQATDFMSL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen THY1 (AAH05175, 1 a.a. ~ 161 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 7070

Enviar un mensaje


THY1 MaxPab mouse polyclonal antibody (B01)

THY1 MaxPab mouse polyclonal antibody (B01)