THRSP monoclonal antibody (M01), clone 2F8
  • THRSP monoclonal antibody (M01), clone 2F8

THRSP monoclonal antibody (M01), clone 2F8

Ref: AB-H00007069-M01
THRSP monoclonal antibody (M01), clone 2F8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant THRSP.
Información adicional
Size 100 ug
Gene Name THRSP
Gene Alias MGC21659|S14|SPOT14
Gene Description thyroid hormone responsive (SPOT14 homolog, rat)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq MQVLTKRYPKNCLLTVMDRYAAEVHNMEQVVMIPSLLRDVQLSGPGGQAQAEAPDLYTYFTMLKAICVDVDHGLLPREEWQAKV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen THRSP (NP_003242.1, 1 a.a. ~ 84 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7069
Clone Number 2F8
Iso type IgG2a Kappa

Enviar un mensaje


THRSP monoclonal antibody (M01), clone 2F8

THRSP monoclonal antibody (M01), clone 2F8