THOP1 monoclonal antibody (M01A), clone 2B4
  • THOP1 monoclonal antibody (M01A), clone 2B4

THOP1 monoclonal antibody (M01A), clone 2B4

Ref: AB-H00007064-M01A
THOP1 monoclonal antibody (M01A), clone 2B4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant THOP1.
Información adicional
Size 200 uL
Gene Name THOP1
Gene Alias EP24.15|MEPD_HUMAN|MP78|TOP
Gene Description thimet oligopeptidase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq ILKELVTLRAQKSRLLGFHTHADYVLEMNMAKTSQTVATFLDELAQKLKPLGEQERAVILELKRAECERRGLPFDGRIRAWDMRYYMNQVEETRYCVDQN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen THOP1 (NP_003240.1, 255 a.a. ~ 354 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 7064
Clone Number 2B4
Iso type IgM Kappa

Enviar un mensaje


THOP1 monoclonal antibody (M01A), clone 2B4

THOP1 monoclonal antibody (M01A), clone 2B4