TGIF polyclonal antibody (A01)
  • TGIF polyclonal antibody (A01)

TGIF polyclonal antibody (A01)

Ref: AB-H00007050-A01
TGIF polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant TGIF.
Información adicional
Size 50 uL
Gene Name TGIF1
Gene Alias HPE4|MGC39747|MGC5066|TGIF
Gene Description TGFB-induced factor homeobox 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq PGSVLARPSVICHTTVTALKDVPFSLCQSVGVGQNTDIQQIAAKNFTDTSLMYPEDTCKSGPSTNTQSGLFNTPPPTPPDLNQDFSGFQLLVDVALKRAAEMELQAKLTA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TGIF (NP_003235, 163 a.a. ~ 272 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 7050

Enviar un mensaje


TGIF polyclonal antibody (A01)

TGIF polyclonal antibody (A01)