TGFB1 monoclonal antibody (M02A), clone 4E1
  • TGFB1 monoclonal antibody (M02A), clone 4E1

TGFB1 monoclonal antibody (M02A), clone 4E1

Ref: AB-H00007040-M02A
TGFB1 monoclonal antibody (M02A), clone 4E1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TGFB1.
Información adicional
Size 200 uL
Gene Name TGFB1
Gene Alias CED|DPD1|TGFB|TGFbeta
Gene Description transforming growth factor, beta 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TGFB1 (NP_000651, 279 a.a. ~ 390 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 7040
Clone Number 4E1
Iso type IgG

Enviar un mensaje


TGFB1 monoclonal antibody (M02A), clone 4E1

TGFB1 monoclonal antibody (M02A), clone 4E1