TG polyclonal antibody (A02)
  • TG polyclonal antibody (A02)

TG polyclonal antibody (A02)

Ref: AB-H00007038-A02
TG polyclonal antibody (A02)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant TG.
Información adicional
Size 50 uL
Gene Name TG
Gene Alias AITD3|TGN
Gene Description thyroglobulin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq PYEFSRKVPTFATPWPDFVPRAGGENYKEFSELLPNRQGLKKADCSFWSKYISSLKTSADGAKGGQSAESEEEELTAGSGLREDLLSLQEPGSKTYSK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TG (NP_003226, 2671 a.a. ~ 2768 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 7038

Enviar un mensaje


TG polyclonal antibody (A02)

TG polyclonal antibody (A02)