TFR2 monoclonal antibody (M01), clone 3C5
  • TFR2 monoclonal antibody (M01), clone 3C5

TFR2 monoclonal antibody (M01), clone 3C5

Ref: AB-H00007036-M01
TFR2 monoclonal antibody (M01), clone 3C5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TFR2.
Información adicional
Size 100 ug
Gene Name TFR2
Gene Alias HFE3|MGC126368|TFRC2
Gene Description transferrin receptor 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq IRLSHDRLLPLDFGRYGDVVLRHIGNLNEFSGDLKARGLTLQWVYSARGDYIRAAEKLRQEIYSSEERDERLTRMYNVRIMRVEFYFLSQYVSPADSPFR*
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TFR2 (NP_003218, 631 a.a. ~ 731 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7036
Clone Number 3C5
Iso type IgG1 Kappa

Enviar un mensaje


TFR2 monoclonal antibody (M01), clone 3C5

TFR2 monoclonal antibody (M01), clone 3C5