TFF2 purified MaxPab rabbit polyclonal antibody (D01P)
  • TFF2 purified MaxPab rabbit polyclonal antibody (D01P)

TFF2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00007032-D01P
TFF2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human TFF2 protein.
Información adicional
Size 100 ug
Gene Name TFF2
Gene Alias SML1|SP
Gene Description trefoil factor 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MGRRDAQLLAALLVLGLCALAGSEKPSPCQCSRLSPHNRTNCGFPGITSDQCFDNGCCFDSSVTGVPWCFHPLPKQESDQCVMEVSDRRNCGYPGISPEECASRKCCFSNFIFEVPWCFFPKSVEDCHY
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TFF2 (NP_005414.1, 1 a.a. ~ 129 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7032

Enviar un mensaje


TFF2 purified MaxPab rabbit polyclonal antibody (D01P)

TFF2 purified MaxPab rabbit polyclonal antibody (D01P)