AB-H00007023-M02A
Producto nuevo
Este producto ya no esta disponible
Fecha disponibilidad
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Size | 200 uL |
Gene Name | TFAP4 |
Gene Alias | AP-4|bHLHc41 |
Gene Description | transcription factor AP-4 (activating enhancer binding protein 4) |
Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
Application Key | WB-Ti,WB-Ce,WB-Re,ELISA |
Immunogen Prot. Seq | AEYIFSLEQEKTRLLQQNTQLKRFIQELSGSSPKRRRAEDKDEGIGSPDIWEDEKAEDLRREMIELRQQLDKERSVRMMLEEQVRSLEAHMYPEKLKVIA |
Antigen species Target species | Human |
Quality control testing | Antibody Reactive Against Recombinant Protein. |
Immunogen | TFAP4 (NP_003214, 93 a.a. ~ 192 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Storage Buffer | In ascites fluid |
Gene ID | 7023 |
Clone Number | 7C5 |
Iso type | IgG2a Kappa |