TFAP4 monoclonal antibody (M01), clone 6B1
  • TFAP4 monoclonal antibody (M01), clone 6B1

TFAP4 monoclonal antibody (M01), clone 6B1

Ref: AB-H00007023-M01
TFAP4 monoclonal antibody (M01), clone 6B1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TFAP4.
Información adicional
Size 100 ug
Gene Name TFAP4
Gene Alias AP-4|bHLHc41
Gene Description transcription factor AP-4 (activating enhancer binding protein 4)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq AEYIFSLEQEKTRLLQQNTQLKRFIQELSGSSPKRRRAEDKDEGIGSPDIWEDEKAEDLRREMIELRQQLDKERSVRMMLEEQVRSLEAHMYPEKLKVIA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TFAP4 (NP_003214, 93 a.a. ~ 192 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7023
Clone Number 6B1
Iso type IgG2a Kappa

Enviar un mensaje


TFAP4 monoclonal antibody (M01), clone 6B1

TFAP4 monoclonal antibody (M01), clone 6B1