TFAP4 purified MaxPab rabbit polyclonal antibody (D01P)
  • TFAP4 purified MaxPab rabbit polyclonal antibody (D01P)

TFAP4 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00007023-D01P
TFAP4 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human TFAP4 protein.
Información adicional
Size 100 ug
Gene Name TFAP4
Gene Alias AP-4|bHLHc41
Gene Description transcription factor AP-4 (activating enhancer binding protein 4)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MEYFMVPTQKVPSLQHFRKTEKEVIGGLCSLANIPLTPETQRDQERRIRREIANSNERRRMQSINAGFQSLKTLIPHTDGEKLSKAAILQQTAEYIFSLEQEKTRLLQQNTQLKRFIQELSGSSPKRRRAEDKDEGIGSPDIWEDEKAEDLRREMIELRQQLDKERSVRMMLEEQVRSLEAHMYPEKLKVIAQQVQLQQQQEQVRLLHQEKLEREQQQLRTQLLPPPAPTHHPTVIVPAPPPPPSHHINVVTMGP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TFAP4 (NP_003214.1, 1 a.a. ~ 338 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7023

Enviar un mensaje


TFAP4 purified MaxPab rabbit polyclonal antibody (D01P)

TFAP4 purified MaxPab rabbit polyclonal antibody (D01P)