TFAP2C MaxPab mouse polyclonal antibody (B01P)
  • TFAP2C MaxPab mouse polyclonal antibody (B01P)

TFAP2C MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00007022-B01P
TFAP2C MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human TFAP2C protein.
Información adicional
Size 50 ug
Gene Name TFAP2C
Gene Alias AP2-GAMMA|ERF1|TFAP2G|hAP-2g
Gene Description transcription factor AP-2 gamma (activating enhancer binding protein 2 gamma)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MLWKITDNVKYEEDCEDRHDGSSNGNPRVPHLSSAGQHLYSPAPPLSHTGVAEYQPPPYFPPPYQQLAYSQSADPYSHLGEAYAAAINPLHQPAPTGSQQQAWPGRQSQEGAGLPSHHGRPAGLLPHLSGLEAGAVSARRDAYRRSDLLLPHAHALDAAGLAENLGLHDMPHQMDEVQNVDDQHLLLHDQTVIRKGPISMTKNPLNLPCQKELVGAVMNPTEVFCSVPGRLSLLSSTSKYKVTVAEVQRRLSPPE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TFAP2C (NP_003213.1, 1 a.a. ~ 450 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7022

Enviar un mensaje


TFAP2C MaxPab mouse polyclonal antibody (B01P)

TFAP2C MaxPab mouse polyclonal antibody (B01P)