TFAP2B monoclonal antibody (M02), clone 2F6
  • TFAP2B monoclonal antibody (M02), clone 2F6

TFAP2B monoclonal antibody (M02), clone 2F6

Ref: AB-H00007021-M02
TFAP2B monoclonal antibody (M02), clone 2F6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TFAP2B.
Información adicional
Size 100 ug
Gene Name TFAP2B
Gene Alias AP-2B|AP2-B|MGC21381
Gene Description transcription factor AP-2 beta (activating enhancer binding protein 2 beta)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA,IF
Immunogen Prot. Seq DPYSHVNDPYSLNPLHQPQQHPWGQRQRQEVGSEAGSLLPQPRAALPQLSGLDPRRDYHSVRRPDVLLHSAHHGLDAGMGDSLSLHGLGHPGMEDVQSVEDANNSGMNLL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TFAP2B (NP_003212, 73 a.a. ~ 182 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7021
Clone Number 2F6
Iso type IgG1 Kappa

Enviar un mensaje


TFAP2B monoclonal antibody (M02), clone 2F6

TFAP2B monoclonal antibody (M02), clone 2F6