TF monoclonal antibody (M08), clone 1C2
  • TF monoclonal antibody (M08), clone 1C2

TF monoclonal antibody (M08), clone 1C2

Ref: AB-H00007018-M08
TF monoclonal antibody (M08), clone 1C2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TF.
Información adicional
Size 100 ug
Gene Name TF
Gene Alias DKFZp781D0156|PRO1557|PRO2086
Gene Description transferrin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq FVKHQTVPQNTGGKNPDPWAKNLNEKDYELLCLDGTRKPVEEYANCHLARAPNHAVVTRKDKEACVHKILRQQQHLFGSNVTDCSGNFCLFRSETKDLLF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TF (AAH59367, 551 a.a. ~ 650 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7018
Clone Number 1C2
Iso type IgG2a Kappa

Enviar un mensaje


TF monoclonal antibody (M08), clone 1C2

TF monoclonal antibody (M08), clone 1C2