TEP1 polyclonal antibody (A01)
  • TEP1 polyclonal antibody (A01)

TEP1 polyclonal antibody (A01)

Ref: AB-H00007011-A01
TEP1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant TEP1.
Información adicional
Size 50 uL
Gene Name TEP1
Gene Alias TLP1|TP1|TROVE1|VAULT2|p240
Gene Description telomerase-associated protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq ASMDSDASMDSEPTPHLKTRQRRKIHSGSVTALHVLPELLVTASKDRDVKLWERPSMQLLGLFRCEGSVSCLEPWLGANSTLQLAVGDVQGNVYFLNWE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TEP1 (NP_009041, 2529 a.a. ~ 2627 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 7011

Enviar un mensaje


TEP1 polyclonal antibody (A01)

TEP1 polyclonal antibody (A01)