TECTA monoclonal antibody (M03), clone 2A5
  • TECTA monoclonal antibody (M03), clone 2A5

TECTA monoclonal antibody (M03), clone 2A5

Ref: AB-H00007007-M03
TECTA monoclonal antibody (M03), clone 2A5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TECTA.
Información adicional
Size 100 ug
Gene Name TECTA
Gene Alias DFNA12|DFNA8|DFNB21
Gene Description tectorin alpha
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq YATPTRDSNDKLRYFIIEGGCQNLKDNTIGIEENAVSLTCRFHVTVFKFIGDYDEVHLHCAVSLCDSEKYSCKITCPHNSRIATDYTKEPKEQIISVGPI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TECTA (NP_005413, 1981 a.a. ~ 2080 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7007
Clone Number 2A5
Iso type IgG2a Kappa

Enviar un mensaje


TECTA monoclonal antibody (M03), clone 2A5

TECTA monoclonal antibody (M03), clone 2A5