TEAD4 purified MaxPab rabbit polyclonal antibody (D01P)
  • TEAD4 purified MaxPab rabbit polyclonal antibody (D01P)

TEAD4 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00007004-D01P
TEAD4 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human TEAD4 protein.
Información adicional
Size 100 ug
Gene Name TEAD4
Gene Alias EFTR-2|MGC9014|RTEF1|TCF13L1|TEF-3|TEFR-1|hRTEF-1B
Gene Description TEA domain family member 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAAMSSAQIISATAFHSSMALARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTYAVQPPLPLPGFESPAGPAPSPSAPPAPPWQGRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFPEKKGGLKDLFERGPSNAFFLVKFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYSYRIHRSPLCEYMINFIHKLKHLPEKY
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TEAD4 (NP_958851.1, 1 a.a. ~ 305 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7004

Enviar un mensaje


TEAD4 purified MaxPab rabbit polyclonal antibody (D01P)

TEAD4 purified MaxPab rabbit polyclonal antibody (D01P)