TDO2 purified MaxPab rabbit polyclonal antibody (D01P)
  • TDO2 purified MaxPab rabbit polyclonal antibody (D01P)

TDO2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00006999-D01P
TDO2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human TDO2 protein.
Información adicional
Size 100 ug
Gene Name TDO2
Gene Alias TDO|TPH2|TRPO
Gene Description tryptophan 2,3-dioxygenase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MSGCPFLGNNFGYTFKKLPVEGSEEDKSQTGVNRASKGGLIYGNYLHLEKVLNAQELQSETKGNKIHDEHLFIITHQAYELWFKQILWELDSVREIFQNGHVRDERNMLKVVSRMHRVSVILKLLVQQFSILETMTALDFNDFREYLSPASGFQSLQFRLLENKIGVLQNMRVPYNRRHYRDNFKGEENELLLKSEQEKTLLELVEAWLERTPGLEPHGFNFWGKLEKNITRGLEEEFIRIQAKEESEEKEEQVA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TDO2 (NP_005642.1, 1 a.a. ~ 406 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6999

Enviar un mensaje


TDO2 purified MaxPab rabbit polyclonal antibody (D01P)

TDO2 purified MaxPab rabbit polyclonal antibody (D01P)