TDO2 polyclonal antibody (A01)
  • TDO2 polyclonal antibody (A01)

TDO2 polyclonal antibody (A01)

Ref: AB-H00006999-A01
TDO2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant TDO2.
Información adicional
Size 50 uL
Gene Name TDO2
Gene Alias TDO|TPH2|TRPO
Gene Description tryptophan 2,3-dioxygenase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq PFQLLTSLMDIDSLMTKWRYNHVCMVHRMLGSKAGTGGSSGYHYLRSTVSDRYKVFVDLFNLSTYLIPRHWIPKMNPTIHKFLYTAEYCDSSYFSSDES
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TDO2 (NP_005642, 307 a.a. ~ 405 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6999

Enviar un mensaje


TDO2 polyclonal antibody (A01)

TDO2 polyclonal antibody (A01)