TDGF1 purified MaxPab mouse polyclonal antibody (B01P)
  • TDGF1 purified MaxPab mouse polyclonal antibody (B01P)

TDGF1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00006997-B01P
TDGF1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human TDGF1 protein.
Información adicional
Size 50 ug
Gene Name TDGF1
Gene Alias CR|CRGF|CRIPTO|Cripto-1
Gene Description teratocarcinoma-derived growth factor 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MDCRKMARFSYSVIWIMAISKVFELGLVAGLGHQEFARPSRGYLAFRDDSIWPQEEPAIRPRSSQRVPPMGIQHSKELNRTCCLNGGTCMLGSFCACPPSFYGRNCEHDVRKENCGSVPHDTWLPKKCSLCKCWHGQLRCFPQAFLPGCDGLVMDEHLVASRTPELPPSARTTTFMLVGICLSIQSYY
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TDGF1 (NP_003203.1, 1 a.a. ~ 188 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6997

Enviar un mensaje


TDGF1 purified MaxPab mouse polyclonal antibody (B01P)

TDGF1 purified MaxPab mouse polyclonal antibody (B01P)