TCTE3 polyclonal antibody (A01)
  • TCTE3 polyclonal antibody (A01)

TCTE3 polyclonal antibody (A01)

Ref: AB-H00006991-A01
TCTE3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant TCTE3.
Información adicional
Size 50 uL
Gene Name TCTE3
Gene Alias MGC142199|TCTEX1D3
Gene Description t-complex-associated-testis-expressed 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq SVETKVQQILTESLKDVKYDDKVFSHLSLELADRILLAVKEFGYHRYKFIIKVLFIQKTGQAINIASRWIWDIAWDSWVAAKHEAESYVALVLVFALYYE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TCTE3 (NP_777570, 99 a.a. ~ 198 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6991

Enviar un mensaje


TCTE3 polyclonal antibody (A01)

TCTE3 polyclonal antibody (A01)