TCP11 monoclonal antibody (M07), clone 2E3
  • TCP11 monoclonal antibody (M07), clone 2E3

TCP11 monoclonal antibody (M07), clone 2E3

Ref: AB-H00006954-M07
TCP11 monoclonal antibody (M07), clone 2E3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TCP11.
Información adicional
Size 100 ug
Gene Name TCP11
Gene Alias D6S230E|KIAA0229|MGC111103
Gene Description t-complex 11 homolog (mouse)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq NTASLMGQLQNIAKKENCVCSVIDQRIHLFLKCCLVLGVQRSLLDLPGGLTLIEAELAELGQKFVNLTHHNQQVFGPYYTEILKTLISPAQALETKVESV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TCP11 (NP_061149.1, 342 a.a. ~ 441 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6954
Clone Number 2E3
Iso type IgG2a Kappa

Enviar un mensaje


TCP11 monoclonal antibody (M07), clone 2E3

TCP11 monoclonal antibody (M07), clone 2E3