TCP11 purified MaxPab mouse polyclonal antibody (B01P)
  • TCP11 purified MaxPab mouse polyclonal antibody (B01P)

TCP11 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00006954-B01P
TCP11 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human TCP11 protein.
Información adicional
Size 50 ug
Gene Name TCP11
Gene Alias D6S230E|KIAA0229|MGC111103
Gene Description t-complex 11 homolog (mouse)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAPKGILGSFPTAMNLSLEGKVKETVHNAFWDHLKEQLSATPPDFSCALELLKEIKEILLSLLLPRQNRLRIEIEEALDMDLLKQEAEHGALKVLYLSKYVLNMMALLCAPVRDEAVQKLENITDPVWLLRGIFQVLGRMKMDMVNYTIQSLQPHLQEHSIQYERAKFQELLNKQPSLLNHTTKWLTQAAGDLTMSPPTCPDTSDSSSVAGPSPNEAANNPEPLSPTMVLCQGFLNLLLWDLENEEFPETLLMDR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TCP11 (NP_061149.1, 1 a.a. ~ 441 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6954

Enviar un mensaje


TCP11 purified MaxPab mouse polyclonal antibody (B01P)

TCP11 purified MaxPab mouse polyclonal antibody (B01P)