Ver mas grande
TCN1 MaxPab rabbit polyclonal antibody (D01)
AB-H00006947-D01
Producto nuevo
TCN1 MaxPab rabbit polyclonal antibody (D01)
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 uL |
| Gene Name | TCN1 |
| Gene Alias | TC1|TCI |
| Gene Description | transcobalamin I (vitamin B12 binding protein, R binder family) |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Tr,IP |
| Immunogen Prot. Seq | MRQSHQLPLVGLLLFSFIPSQLCEICEVSEENYIRLKPLLNTMIQSNYNRGTSAVNVVLSLKLVGIQIQTLMQKMIQQIKYNVKSRLSDVSSGELALIILALGVCRNAEENLIYDYHLIDKLENKFQAEIENMEAHNGTPLTNYYQLSLDVLALCLFNGNYSTAEVVNHFTPENKNYYFGSQFSVDTGAMAVLALTCVKKSLINGQIKADEGSLKNISIYTKSLVEKILSEKKENGLIGNTFSTGEAMQALFVSS |
| Antigen species Target species | Human |
| Quality control testing | Antibody reactive against mammalian transfected lysate. |
| Immunogen | TCN1 (NP_001053.2, 1 a.a. ~ 433 a.a) full-length human protein. |
| Storage Buffer | No additive |
| Gene ID | 6947 |
Más información
Rabbit polyclonal antibody raised against a full-length human TCN1 protein.